PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_21803A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 374aa    MW: 42196.4 Da    PI: 10.1599
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_21803AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.77.1e-15453148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                               r+rW +eEd  l  +v+q+G++ W++++++m+  +gR +k+c +rw +yl
  Oropetium_20150105_21803A  4 RQRWRPEEDAVLRAYVRQFGPREWHLVSQRMNvaLGRDAKSCLERWKNYL 53
                               89**********************************************97 PP

2Myb_DNA-binding35.91.7e-1159103147
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                +g+ T+eE+ + +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
  Oropetium_20150105_21803A  59 KGSLTEEEQRQVIRLQAKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 103
                                6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.154153IPR017930Myb domain
SMARTSM007171.0E-11355IPR001005SANT/Myb domain
SuperFamilySSF466895.99E-21498IPR009057Homeodomain-like
CDDcd001675.76E-8653No hitNo description
Gene3DG3DSA:1.10.10.601.3E-20660IPR009057Homeodomain-like
PfamPF139213.8E-12769No hitNo description
PROSITE profilePS5129423.00354108IPR017930Myb domain
SMARTSM007173.9E-1058106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-1561102IPR009057Homeodomain-like
CDDcd001671.83E-763104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010338Biological Processleaf formation
GO:0042742Biological Processdefense response to bacterium
GO:0045088Biological Processregulation of innate immune response
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:0000793Cellular Componentcondensed chromosome
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MKERQRWRPE EDAVLRAYVR QFGPREWHLV SQRMNVALGR DAKSCLERWK NYLRPGIKKG  60
SLTEEEQRQV IRLQAKHGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQQRE IRDSRRPPPE  120
PSPDERGRYE WLLENFAEKL VNERQQDAAL MAAPVLPPWL SSTNAGPAAV TQPPCPPSVT  180
LSLASAAVAP PAPAPPAWMP PPDRGAAAEA FGFPSPQVVA PPTGVAAPPP PRPAGMVAVV  240
EGQALAELVE CCRELDEGQR AWAAHRREAA WRLKRVEQQL EAEREMRRRE VWEEFEARMR  300
AXXXXXXXXX XXXXXXXXXX XXXXRRDAQA KEEKMAEQWA AKHARVAVFL DQVAGGGGGC  360
HPPARPWSSA EMN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-157101798MYB PROTO-ONCOGENE PROTEIN
1mse_C6e-157101798C-Myb DNA-Binding Domain
1msf_C6e-157101798C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794690.0HF679469.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB63 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002443396.11e-142hypothetical protein SORBIDRAFT_08g018840
SwissprotQ9S7B21e-143RS2_MAIZE; Protein rough sheath 2
TrEMBLC5YQ951e-142C5YQ95_SORBI; Putative uncharacterized protein Sb08g018840
STRINGSb08g018840.11e-141(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51903654
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.14e-86MYB family protein